cytokine domain of tyrosyl tRNA synthetase



cytokine domain of tyrosyl tRNA synthetase


SMILES None
InChIKey None
Sequence PEEVIPSRLDIRVGKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVVLCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGYEKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSLKGGNIS

Chemical Properties

Hydrogen bond acceptors None
Hydrogen bond donors None
Rotatable bonds None
Molecular weight (Da)

Database connections



No bioactivity data available.

cytokine domain of tyrosyl tRNA synthetase


Drug properties

Molecular type Peptide
Physiological/Surrogate Endogenous
Approved drug No

Distribution across phases (no. indications)

Phase I 0
Phase II 0
Phase III 0
Phase IV 0

Database connections



Compound is not listed as a drug.